Insulin-like growth factor 1 (IGF-1), also called somatomedin C, is a protein that in humans is encoded by the IGF1 gene. IGF-1 is a hormone similar in molecular structure to insulin. It plays an important role in childhood growth and continues to have anabolic effects in adults. A synthetic analog of IGF-1, mecasermin, is used for the treatment of growth failure.
Expression System Escherichia coli
Sequence MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSC DLRRLEMYCAPLKPAKSA with polyhistidine tag at the C-terminus.
Species Human
Tag polyhistidine tag at the C-terminus
Endotoxin Level <0.01 EU per 1 μg of the protein by the LAL method.
Activity
Measured by its ability to induce MCF-7 cell proliferation.
The ED50 for this effect is 0.9-3.1 ng/mL.
The specific activity of recombinant human IGF-I is approximate>1.2 x 10³ IU/mg.
Purity >95% as determined by SDS-PAGE. Ni-NTA chromatography
Formulation The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 minutes to ensure sufficient re-dissolved.
Storage
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquotsshould be stored at -20°C or -80°C.Avoid repeated freeze/thaw cycles.
Note Please use within one month after protein reconstitution.
SDS-PAGE analysis of recombinant human IGF-1
Related Ordering Information
| Cat. No. | Description | Size |
|---|---|---|
| CC103-0500 | DMEM, High Glucose | 500 ml |
| CC109-0500 | RPMI 1640 | 500 ml |
| CC113-0500 | DMEM/F-12 | 500 ml |
| PC203-0600 | 60mm Tissue Culture Dish, with Gripping Ring | 600 ea |
| PC273-0100 | 75T Flask, Plug Seal Cap | 100 ea |
Caution
During operation, always wear a lab coat, disposable gloves, and protective equipment.
Research Use Only. Not intended for any animal or human therapeutic or diagnostic uses.
