GeneDireX, Inc.

Category

  • Loading ...

Interleukin-7 (IL-7), Human

GMP Grade Available!


Size: 100 μg


Storage
Lyophilized protein should be stored at -20°C.
This product is stable for one year upon receipt, when handled and stored as instructed.
Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Avoid repeated freeze/thaw cycles.


Note
Please use within one month after protein reconstitution.

IL-7 is an important cytokine for B and T cell development. IL-7 and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. IL-7 is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. IL-7 can be produced by intestinal epithelial and epithelial goblet cells and may serve as a regulatory factor for intestinal mucosal lymphocytes. Knockout mice studies suggested that this cytokine plays an essential role in lymphoid cell survival.


Expression System
Escherichia coli


Sequence
MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH with polyhistidine tag at the C-terminus


Species
Human


Tag
polyhistidine tag at the C-terminus


Endotoxin Level
<0.1 EU per 1 μg of the protein by the LAL method.


Activity
Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED₅₀ for this effect is <0.8 ng/mL. The specific activity of recombinant human IL-7 is > 7 x 10⁸ IU/mg.


Purity
>95% as determined by SDS-PAGE. Ni-NTA chromatography


Formulation
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.


Reconstitution
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 minutes to ensure sufficient re-dissolved.


 

SDS-PAGE analysis of recombinant human IL-7

Protocol

SR109-0100

SR109-0100G

Document Searching (Protocol, CoA, SDS)

Search unsuccessful? Please contact us