GeneDireX, Inc.

Category

  • Loading ...

Interleukin-21 (IL-21), Human

Size: 100 μg


Storage
Lyophilized protein should be stored at -20°C.
This product is stable for one year upon receipt, when handled and stored as instructed.
Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Avoid repeated freeze/thaw cycles.


Note
Please use within one month after protein reconstitution.

IL-21 is produced by CD4+ T cells in response to antigenic stimulation, which enhances antigen-specific responses of immune cells. IL-21 exerts its effect through binding to a specific type I cytokine receptor, IL-21R, which also contains the gamma chain found in other cytokine receptors including IL-2, IL-4, IL-7, IL-9 and IL-15. The IL-21/IL-21R interaction triggers a cascade of events which includes activation of the tyrosine kinases JAK1 and JAK3, followed by activation of the transcription factors STAT1 and STAT3.


Expression System
Escherichia coli


Sequence
MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS with polyhistidine tag at the C-terminus.


Species
Human


Tag
polyhistidine tag at the C-terminus


Endotoxin Level
<0.1 EU per 1 μg of the protein by the LAL method.


Activity
Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED₅₀ for this effect is <10 ng/mL.


Purity
>95% as determined by SDS-PAGE. Ni-NTA chromatography


Formulation
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.


Reconstitution
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 minutes to ensure sufficient re-dissolved.


SDS-PAGE analysis of recombinant human IL-21

Protocol

SR126-0100

Document Searching (Protocol, CoA, SDS)

Search unsuccessful? Please contact us