GeneDireX, Inc.

Category

  • Loading ...

Interleukin-3 (IL-3), Human

GMP Grade Available!


Size: 100 μg


Storage
Lyophilized protein should be stored at -20°C.
This product is stable for one year upon receipt, when handled and stored as instructed.
Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Avoid repeated freeze/thaw cycles.


Note
Please use within one month after protein reconstitution.

IL-3 is a potent growth promoting cytokine, which could support the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders.


Expression System
Escherichia coli


Sequence
MAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF with polyhistidine tag at the C-terminus


Species
Human


Tag
polyhistidine tag at the C-terminus


Endotoxin Level
<0.1 EU per 1 μg of the protein by the LAL method.


Activity
Measure by its ability to induce TF-1 cells proliferation.
The ED₅₀ for this effect is <0.15 ng/mL.
The specific activity of recombinant human IL-3 is approximately >1.2 x 10⁶ IU/mg.


Purity
>98% as determined by SDS-PAGE. Ni-NTA chromatography


Formulation
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.


Reconstitution
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 minutes to ensure sufficient re-dissolved.



SDS-PAGE analysis of recombinant human IL-3

Protocol

SR105-0100

SR105-0100G

Document Searching (Protocol, CoA, SDS)

Search unsuccessful? Please contact us