GeneDireX, Inc.

Category

  • Loading ...

Interleukin-6 (IL-6), Human

GMP Grade Available!


Size: 100 μg


Storage
Lyophilized protein should be stored at -20°C.
This product is stable for one year upon receipt, when handled and stored as instructed.
Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Avoid repeated freeze/thaw cycles.


Note
Please use within one month after protein reconstitution.

Cat.No. SR108-0100 Categories ,

Il-6 is a cytokine with a wide variety of biological functions: it plays an essential role in the final differentiation of b-cells into ig-secreting cells, it induces myeloma and plasmacytoma growth, it induces nerve cells differentiation, in hepatocytes it induces acute phase reactants.


Expression System
Escherichia coli


Sequence
MVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM with polyhistidine tag at the C-terminus.


Species
Human


Tag
polyhistidine tag at the C-terminus


Endotoxin Level
<0.1 EU per 1 μg of the protein by the LAL method.


Activity
Measure by its ability to induce proliferation in TF-1 cells.
The ED50 for this effect is <0.5 ng/mL.
The specific activity of recombinant human IL-6 is approximately >5 x 10⁸ IU/mg.
Measure by its ability to induce proliferation in MCF-7 cells.
The ED50 for this effect is <4.4 ng/mL.


Purity
>98% as determined by SDS-PAGE. Ni-NTA chromatography


Formulation
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.


Reconstitution
Unopened ampoules can be stored at -20°C or -80°C.
Need not spin the ampoule. Open the cap carefully, then dissolve the lyophilized protein with sterile water for a 100 μg/mL concentration or according to the product’s Certificate of Analysis (CoA). Rinse the inner side of the ampoule gently and stand for at least 20 minutes at room temperature. (Important Note: Do Not Vortex!) Use the reconstituted solution immediately or store it by distributing it to aliquots and store at -20 °C. (Avoid repeated freeze-thaw cycles) We recommend diluting the solution to working concentration by using buffers or medium containing a carrier*. (Do not dilute the working solution with water, which may cause protein degradation.)
*Carriers: 0.1% BSA or 5% HSA or 10% FBS.


SDS-PAGE analysis of recombinant human IL-6

Protocol

SR108-0100

SR108-0100G

Document Searching (Protocol, CoA, SDS)

Search unsuccessful? Please contact us