GeneDireX, Inc.

Category

  • Loading ...

Vascular Endothelial Growth Factor 165 (VEGF165), Human

Size: 100 μg


Storage
Lyophilized protein should be stored at -20°C.
This product is stable for one year upon receipt, when handled and stored as instructed.
Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Avoid repeated freeze/thaw cycles.


Note
Please use within one month after protein reconstitution.

Vascular endothelial growth factor (VEGF) is an important signaling protein involved in vessel formation. VEGF mediates increased vascular permeability, induces vasculogenesis and endothelial cell production, promotes cell migration, and inhibits apoptosis. In vitro, VEGF has been shown to stimulate endothelial cell mitogenesis and cell migration. VEGF is also a vasodilator and increases microvascular permeability and was originally referred to as vascular permeability factor.


Expression System
Escherichia coli


Sequence

MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR with polyhistidine tag at the C-terminus.


Species
Human


Tag
polyhistidine tag at the C-terminus


Endotoxin Level
<0.1 EU per 1 μg of the protein by the LAL method.


Activity
Measure by its ability to induce HUVEC cells proliferation.
The ED50 for this effect is <5 ng/mL.
The specific activity of recombinant human VEGF165 is approximately >1.4 x 106 IU/mg.


Purity
>98% as determined by SDS-PAGE. Ni-NTA chromatography


Formulation

The protein was lyophilized from a solution containing 1X PBS, pH 8.0.


Reconstitution
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 minutes to ensure sufficient re-dissolved.


SDS-PAGE analysis of recombinant human VEGF165

Protocol

SR224-0100

Document Searching (Protocol, CoA, SDS)

Search unsuccessful? Please contact us